TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B9KFF7|B9KFF7_CAMLR Major outer membrane protein OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=porA1 PE=4 SV=1
MKLVKLSLVAALAAGAFSAANAVSLEEAIKDVDVSGMMRYRFQSDRLDAGAKPYTGFTPDIQEKGYNSSKNNEHKFKAQL
NFKAALDDNFKAFVQFQYSTTEYGYGRTGSEQDNNLKKSGTDTHSTFAVQQAYLEYTNEAYATNVIFGKMEVGFIWTDDA
VGTGAKVLNNSIEGLTFAGYWFDSFNDEDDGDFGPTKLNKSSLYGAAVLGDFDPFAFQLWAAYSANNAFLYAVDASYKFA
FNDMNFKVQAQYLGNSLDSDFENYYKNNIKLLDGEVDNGNFYAGKFSADLYNFDFQAGVVGYGEKNRFSVVTLEDTGRVI
APGQQIFYSTGSNLTGDKGENFFYFAGLGYTFAETLRVGFDYIGGKTKYTNVDTDKYEMVGSVSYAYSPKLTFSGFYSYL
SEDFNKAGVDDANDQFIRLEALYKF