TCDB is operated by the Saier Lab Bioinformatics Group
>tr|B9V2W6|B9V2W6_SIV Vpu protein OS=Simian immunodeficiency virus GN=vpu PE=4 SV=1
MHPRDILVIIIGIILLAVTVISWLKALALYLRDRRERRFFDRLERLISNKEDEGYESNEEEAAELMERGNELGFAFNLH