TCDB is operated by the Saier Lab Bioinformatics Group
>BAR29194.1 P22-like coat protein [uncultured Mediterranean phage uvMED]
MSGAFPTNPLFRALNFQDNRPTLLNQTLSGKKQVRQIGSQYFSFTAQMPPMQQEKAMEIFAFLQKQKGSFEDFTIQAPLD
NLGASKGETDILVNGSHTAADGSIALDGFTASTTGALKAGDLIKFANHSKVYMVQSDIDSDGSGALTVLISPNLVAALAD
NEAVTVNKPSFTVYLENNEIMYSTNASGLYTISFDVREVIT