TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C0P6N0|C0P6N0_MAIZE Uncharacterized protein OS=Zea mays GN=LOC100382332 PE=2 SV=1
MASALSSLRYGDSLSVVGISAATAVLCEAISWLLIYRTATYDSLRASIERHSRKLDAMKSGSNSSGAASSSAQAASSRAK
KMDRVETSLKDAARELSLAKLKSGAVVAAVLFVVFGLLNSLFEGRTVAKLPFAPIPLVQRMSHRGLPGNDPTDCSMVFLY
FLCSMSIRTNLQKLLGFAPPRAVAAAGGGLFPMPDPKVN