TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C0ZLZ7|C0ZLZ7_RHOE4 Putative membrane protein OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=RER_02660 PE=4 SV=1
MATELKARTSRRRSRAAVGLAACAVAALSSGVVFAGSASATPTALSDKFASTVTDDGWSLDLAATKLSANPVPNLATTAF
TREGFVSAKVTGTIGGAGDSAVKTGYVEQGLQIGCQIDVSSGLGLGLGFSLGPSVGVSISGVPSANVGVNASVNPSIQST
IAPGTITTIPLGKKDLESSKASITAENVHVKVDACMGPVTIRSYAQLSVSTATSDNTLFVYSDPTWL