TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C1DVX4|C1DVX4_SULAA Putative uncharacterized protein OS=Sulfurihydrogenibium azorense (strain Az-Fu1 / DSM 15241 / OCM 825) GN=SULAZ_1292 PE=4 SV=1
MKKSLAVLALMGAVGFSQAAVVENPILKKLVEKGILTEQEAAAIDEQLAQEEAEKAKYQAEIDKTAMEAKEKLSKLEKKW
GDMPALAGKFKKFEIGGKAYIGYTYTVDKKQYTGNNDRGDFEVRRFYFDTKAYLNDKDHIRFTTDLSAGTDYKLKIKYGY
LYKDISGLIPHTGFEFGVAHTPWIDFEEHTGWWYRSIDKTFIESSNGMGLWPSADLGINFKTKTPYVSSEIGMFNGEGYD
KINTSSKNSSGIHNSFEGRITYHILGNGDKKLSPTKDQYANVSLHLASNIGYNDAYLTHKNLNLYHIHAVYNHPMFLIAA
QYGKVDYNTQSANAGDGYSVNFEVRPVKDWSIFGRYDYWKPKNKQGTTTAYWDKRRAYYVGVAYTMNKYVKWIINYENFD
YSGKDDLANTAKSSSYFDKSQYKLTAELSW