TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C2UY63|C2UY63_BACCE Putative uncharacterized protein OS=Bacillus cereus Rock3-28 GN=bcere0019_31790 PE=4 SV=1
MVHYNNQNSLHQIFTLKGTVIRDIFPQILLYMCISTVITVINYYYVEIKINQTPWVIVGGALGLLLVFRTNTAYDRYWEG
RKLFGTISASTRNLAVSFLCHWESEEKKTDQEKLKFLHLLIAFPKIAKGHLRDDKDLTEIKALLNICSEKEKEILAESIH
LPISIVFMLKTILSKGLKTGRLHPNVIINMEADLNNLLTAVGGCDRIKTTPIPFAYFTHIKILLLIFCGTLPIGLVDSLG
WFTVLATTFISFAFIGIEAIGVEIEDPFGQDPNDLPLEGICIGVETHVLDLCNQNGLFEVMDMNLDKKIS