TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C3WB45|C3WB45_FUSMR Putative uncharacterized protein OS=Fusobacterium mortiferum ATCC 9817 GN=FMAG_00644 PE=4 SV=1
MKRLALLLAAMGIVSVGAMAEAPTLKVTSIGQEIEIENENGNQTFDDVWLWNNVNLEYGDWQFGLTAGKQWSVDFDGDGA
HSDNGRLQMDVWKKVTPDLKLGTRLRLQDDYDRYYARWDYNGSNNMFFSWGDVWYESNNDDSDVGRKNGTPDYIKAETLP
IGVKVGPVKVGYYFQYYGALGSSEATDNHYESEMEHQIRLYAPLYQGEKLGLSFEGRFTIAEEQDWNNDGKDRADKHAGY
REYDSFGRTRLYVKFDYKVTESLNVYGQYAYEWRDFDYQEGDKREFYAGAGKENYQDILVGWRYTF