TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C3XY89|C3XY89_BRAFL Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_126307 PE=4 SV=1
MTLLKSCCCIFTVKLGSVITGFIFLILCIVDIGVKVGYRDAYGGVAWSSLVFDLIFIIFNVFLIIGAYNDVLWMCALWVV
VALVYLLILLIQNIVATVTGNSNKVIGAGIVQGANAGTWIVFVFVLLIMVYGLLVVVSHCQNLRDEEIRVPRGEPPAEAR
A