TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C3YI39|C3YI39_BRAFL Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_71536 PE=4 SV=1
MKRAVGVGVPLVLILAVSAFLILTASKKDPLSEPGHRVVKRSLPLHSELEDALKAAAAEDAPAYVKDKRFLPAIANLAGN
LLSSGEGFDAGKLTDTIKQLGGMENMGPDIMAQSVKQEAEVEAEVEKEVARETVDKIFEKAEQEKKEEGGDGGDGGDDGG
GGGQEHEIKAEVDFVAEKGMVEDDMFAPPGMEMKIDVEEDPETDSEPDQSSEPEAFSYPMGMGSALMNGCFGSGYKEGDP
CSNQKVVAPACSNMMEGCSYIGVGFDGRGDYSSASRRKTVVQRNCGKAATYQNEDVPDTMNVHGIYDTEVASYVFESRQS
YRHSLQMKAGMSFSGFGFQAAVESAYGKESSSQKQAFMSLIQCNVIRYEIFLDEITPDTLSLPFLRDFLSLPKNFIEGQA
KLQKFIIRYGTHFIKSAKFGGSFRLFKTQEASKSESFEDFSIQAQASYNSLAFNAAGHLGVSSSTGSSYDKQFLCTCDGG
DKSSKTSNTHVTVEGGDQEVASIVADFYSTGFKDTFTEWLKSIPTYPKPIEMFMGTMAELLDLNYKLLFPFDISDAADGC
FSETLKTEDTTGRKYYEVKKLVNNSKGVMEPVTEKRYCDFTSVERFHEGLDKKRLALERAIVMYMEEGPVPTTDFRLSGG
KPGCTTEELKVKGGASGTTYPTWMELINGDTYMVSCFGFVMTYNEATGTFDVTPQDQEASKQVLGNLPRNYADWNVARAE
YVSPLEHSRAKGRSLTAILEAPCTVKWSNSYQIKPAKAGGQCIYFVAASSGDIFVVFSAIPRDKTTWYHLQISYQGVALY
KGMKLVKYEGAKSARSLGDSKLFQPYFICLDEDKANQRTYIKYGIGSDTSEKGLIYMVYNDAGPPFGIRFYSFGSGEEDV
EIMDARIIEGGAQGEMECTGGTIMKDGKCVEDCHPECNGCIPMSPGSKLDTECRSCKHFSLDKGGGVIQCVAVCPAGTEP
APDGKTCACSDFVFDKGGGVTQCVAECPSGFEAGDDGKTCVCKNFVFHNDDGSVQCVKSCGLGYAPGSDGKTCAVASKWR
SDSRCGKGFPAPGANPAWCPPASVSPSGTAMTAVKNDSAPSTSTSEIPPRSLTTPSVVGIITQMGNQLPSHVRECGDAMW
ASVFPDQAVY