TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C4LWU5|C4LWU5_ENTHI Formate/nitrite transporter family protein, putative OS=Entamoeba histolytica OX=5759 GN=EHI_198990 PE=4 SV=1
MPREKPRADEIAIEMMSVCEDETEVEQDPRELYEEEMKEQQQIDCSKQQKEVVAIEELEKRNINKHFFSIQPNTQIPVIS
SNYIAPVDTSRLLVLIGKTKATYPIMKMFSLSVLAGMLLSVGGLLSITIGKGIPSSDIGIQKIVFGFFNSVGLNLVVLCG
GELFTSNCAFLIPGFMEGAYSRWLFFKTHFVVYFGNLVGSIFVSTYFGKLLGSFESPMYLSAVKQIGETKVAMNWGRALL
SGIGCNWLVCCAVYFSASAKDLLSKLVVISFLVLTFASLEFENCVGNMFLLSLSHMYGGNFTLGQWILNNLIPVSIGNFI
GGTFLLGIPLWYVHVSNVYNIPFLDPLYQQSQAKTQ