TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C6WVE5|C6WVE5_METML Colicin V production protein OS=Methylotenera mobilis (strain JLW8 / ATCC BAA-1282 / DSM 17540) GN=Mmol_0985 PE=4 SV=1
MTIFDYIVLSIIGLSVILSVMRGMVREVIAIVGLVAAFYVGVTYTNQLLPMMPMDIPNDALRVLAAFLVLFLATILLATL
LGIALSAIFKKAGLGWLNRFLGALFGVARGLLIVCVIVFLAGLTDIPKDPRWRNAMFSAPIEALVVNLLPWVPEGIAKHV
KYD