TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C7BYV0|C7BYV0_HELPB TlyA protein OS=Helicobacter pylori (strain B38) GN=tlyA PE=4 SV=1
MRLDYALFNQHLANSREKAKALVLKNQVLVNKMVVSKPSFIVKEGDQIELIAPNLLVSRAGEKLGAFLENHFIDFKEKVV
LDVGASKGGFSQVALLKGAKKVLCVDVGKMQLDEGLKNDQRIECYEECDIRGFKTPEKIDLVLCDVSFISLYCILEAIVP
LSGEFLALFKPQFEVGRATKRNKKGVVMDKKAILNALENFKNHLKTKDFQILTIQESLVKGKNGNVEFFIHFKRA