TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C7Z7K1|C7Z7K1_NECH7 Predicted protein OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_66456 PE=1 SV=1
MSNLKDFSQPGSGQESNFGVDFVIHYKVPAAERDEAEAGFVQLIRALTTVGLATEVRHGENESLLVFVKVASPDLFAKQV
YRARLGDWLHGVRVSAPHNDIAQALQDEPVVEAERLRLIYLMITKPHNEGGAGVTPTNAKWKHVESIFPLHSHSFNKEWI
KKWSSKYTLEQTDIDNIRDKFGESVAFYFAFLRSYFRFLVIPSAFGFGAWLLLGQFSYLYALLCGLWSVVFFEYWKKQEV
DLAVQWGVRGVSSIQQSRPEFEWEHEAEDPITGEPVKVYPPMKRVKTQLLQIPFALACVVALGALIVTCNSLEVFINEVY
SGPGKQYLGFLPTIFLVIGTPTISGVLMGAAEKLNAMENYATVDAHDAALIQKQFVLNFMTSYMALFFTAFVYIPFGHIL
HPFLNFWRATAQTLTFSEKELPTREFQINPARISNQMFYFTVTAQIVNFATEVVVPYIKQQAFQKAKQLKSGSKVQEDHE
EEAEFLQRVREECTLEEYDVSGDYREMVMQFGYVAMFSVAWPLAACCFLVNNWVELRSDALKIAISSRRPIPWRTDSIGP
WLTALSFLSWLGSITSSAIVYLCSNSKNGTQGEASPLKAWGLLLSILFAEHFYLVVQLAVRFVLSKLDSPGLQKERKERF
QTKKRLLQENLGQDAAEEAAAPGIEHSEKITREALEEEARQASIRGHGTPEEMFWQRQRGMQETIEIGRRMIEQQLAAGK
NGKKSAPAVPSEKAS