TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C9S8B8|C9S8B8_VERA1 Calcium-binding mitochondrial carrier protein Aralar1 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_00035 PE=3 SV=1
MSKAAAVKEAVKESLLGAEEPTQLSSQTKSRFHANAIKDAETGELFMGPDEFVNAVAPATEDYHKIKREQYGILFRVADR
KDAGRISLSEWAAFENLLMKPDAEYEIAFRLFDVSRTGSVKYEDFRQLYELNKGETSIPFDWECEWAKLYIGGKKKRHQM
DYPQFSQMLRGLQGERIRQAFQQFDRDGDGFIDPEDFERIILETSKHKLSDHLLQNLSSLCNITLGSKVSYANVRAFQNM
IKEMDLVELIVRRAVAKSTDGKITRTEFLNQAAKITRFSLFTPMEADILFHFASLDEPSGRLGLADFAKVLDPSWRNPLY
DTEDAPHRGVSDAAAGATGAAVAKLMESSYNFLLGSVAGAFGAFMVYPIDLVKTRLQNQRGARPGERLYKNSIDCFQKVW
RNEGLRGLYSGVLPQLVGVAPEKAIKLTVNDIVRTYFTNKEGKIYWGSEVLAGGAAGACQVIQGEVAKTMEGTPKRSAMW
IVRNLGLVGLYKGASACLLRDVPFSAIYFPTYSHLKKDMFGESPTKKLGVLQLLTAGAIAGMPAAYLTTPCDVIKTRLQV
EARKGEASYTGLRHAASTIWKEEGFRAFFKGGPARIFRSSPQFGFTLAAYEVLQTSLPYPGKTESLKITTGVADAVSTLK
EKLDTSPYSRSRNALKIILDIDEDFGKIKMPSAQTWKTLPAVMQSGAGKS