TCDB is operated by the Saier Lab Bioinformatics Group
>CAD7625038.1 unnamed protein product [Medioppia subpectinata]
MDWRQYLTLKREKLRNQLTDSEKTNELFAGVCVHINGVTNPSEIELKELIVGFGGMYLTYFDPQLTTHTIASNLAFATTK
RLKTSQIVVKVEWILDSIEANCLQSVDNYLLDKTDPKLMDNKTREEKTTVCQPVLNEDHFDWLSETERQFIEDLPRGLRE
EVLADIELSRELEKQRNDFSDDELYSEETDETSDEMADLMSGDVTCANICGKYRTEEVLDLIAEWITSEEELLEEDVAYI
TKYFLDLIDERNIDLNMSFAGIYFGLFGHFWYKFLDKRFPGSHRRAVLKKLLSEMAMGPPLVSGLFLIVSKLKDKSFEEC
LNDLKTNFVLICSVEWLVYIPLQFLNFSLLRPQFRYLFVAIISLGYDAFLSYVIHRNDRSKRLREIK