TCDB is operated by the Saier Lab Bioinformatics Group
>CEJ57270.1 Putative DUF124 domain protein [Penicillium brasilianum]
MTAAQQKPRTPSLSTQSPPPAVQLYGAPAAGQFTGAQGTNEDSVGTFNGGSYRISHRDSNSLLTLQLAVGCPLTAKPGVM
IAMSTTMTLRGHVSFGWKKLIAGGEMSMSQYTGPGELLLAPSVLGDLIVLRLDGEQEWKIGRDAFLASTSGVKHKYQAQG
LAKGVFSGEGLFVYKITGTGLLWMQSFGAIIKKDLQEGETYFIDNGHLVAWNCKYEMERVASGGIISAFGAGEGLACKFK
GPGTVYLQTRNLNAFAAQMKVSTASG