TCDB is operated by the Saier Lab Bioinformatics Group
>CEL91731.1 unnamed protein product [Vitrella brassicaformis CCMP3155]
MFFMTCIFLYIVVWQMLCNNQHMEVGDVRGVVRMQLQHPTAHHCNPHKPTCMSNYTKLSELPYCKQYKGKDRPHVRKETC
LHQHIHANTTERVYVADIDRFTLLIDHSFEATQKDSMKGSMVEYQGYWEACTGGGECRRLKIPCHGKHCDKKDTPRHPLQ
PPDKDGGWRHFLGLKEERAMADIDMKEPERYWGDYLTDLDELDEVDLHDTSPIPWHDSEELRKFTENPSSIIQILPGDII
SLGRLLSFAGVDLDSNVNQQGESRRAEGLVLSITIKYTNLRPFMTLFHAPIEYVYSVQKAPSYKTVETEKMSDTHRVLYN
RHGIFIDVHQQGNLATFNFSHMLIVLTTSLALLGAATAFTDFCAESLMKHSDEYKQAREEVTKDFSEEDTHCLCWFRPGE
EPKDQEKELESLEEEINNTTTRDQVNKELLEKLDNVTHPYNTWREACAILLVEVSALKKKLKAAIKDLDVQQRVGFSRSP
TAHRASLL