TCDB is operated by the Saier Lab Bioinformatics Group
>CEO99155.1 hypothetical protein PBRA_001060 [Plasmodiophora brassicae]
MSASWQTGRNATGARSPDPPDDESSSLFAAAHSTDMITMTMGELETLKRTMKARLDDVQKRVDRAMQRTEALQTENKRLA
SLVQELTEAKLTSEATDTFAALRALPATRGANGETVDAEAERRRAELRRELLRGLELIAGNDEHEAHLDGAGEGPAPSGM
FASVIEQWNSLVYRVDPFRRDLSYVSSRYGEGVLAVFGFLKSTCMASFFYTIIWGVNLIRLRLNSSTPFTQLTGVLPTWT
LFSGFPSSSSGDILYVSALVACAALAAISAIRKTIADNADVIRAKVLESSNNPKHFSSRTLNLWDFTIKDPQAASDRRNA
VAGQLQILLSEHVLQQKIRGRTPMDLALLWARRTFGLLLNLTALAASWTVIIVLTIDKTVADRFPHEVQGLVAPIATSVI
GSLLPMLTFLITDFERWDNPSTVVKHQMWRLYAGRQLNILINVLSYFTIAKGQALLPQLGSLSVSHDGYTCGVDAAGAGL
FYLVLSEFFVSKIILAGIYIVKKVAKRFVSLELSEYSVSQNIIDLLYFQSLVWISLPLYPAGSILCVLLLFTNFKWERLK
LTVFMSRPLSSWSDKNTTTFFNNFYNVTLATCLLTYMYFLNSSWSCAGNLGPFAGAPGNVPVNVFEAYAEQFGLSILYSI
VTNVAPYLAAAVVLYALWRFRSNHQRTLERLLERTETLHLKETTALRAELDTKQKIIAAQRKAATIS