TCDB is operated by the Saier Lab Bioinformatics Group
>CUQ78194.1 Predicted integral membrane protein [Lachnospira pectinoschiza]
MNRNDVNRKTWYLLILMPVIYLAVSVLVVFLVKNNVAYPTGSDTMYHIFRGDYVYNSIKEGSWYPIYNSMWYNGVEIMRY
WAPLTAYYMALCQMIAGGGQLAGYLIFVGSVCFFNSISWLIIGRKMNRPYLGAFVGLIWFFMPNNLLALFVEGNLARSLC
MIFLPVFIYAVCEYLSERKRIYIPIIIVTFALMAMCHLGYAGMIALAVLIYCIVYMFQQGNKRAVLEVIVSILLGFMVLG
IWLVASLNGGITSLDNSENMANFFQKLVVTLNPLDRIKSNNSHFYYGLAACIIAVCGIFLGYKKSRTGFVTAVVILVCTT
TAMYPVLSLLPGSQYLWMLRFISIALCFILYSFLKWDTLKKPLVLLMCVLLIADIVPSLTLITGGSLFTEDNKISLSGMF
SRYNSTSEDNSSDTSLIDDILSLNMTDTSEAEDRINHTQNYTLISKAQSITGQRLALMDASSLGAMGAWLTADWNNGVPA
AFGAGWEAANTSTNIANLNKAMAESRFYYMFDRCEELGNDTVVVRLSQLNKYTGTLDKLDEAANAVGYKLVDYNGDYRLY
HLDVNGNWGTISTYEAIGIGSGASGISLRFPAVEEMDSYNLDDYTFEQLSQYKEIFLDGFTYNDKEAAEELIIRLSEAGV
KIIISADSIPQDKRTHTQTFLGVTCNAVKFENGYPEMNTRIGRVYTDMFPQGHTEWNTVYLDGLDTSYGSVDDNGLSLDF
YGTVKNDNIIMCGLGIMNFYSMTGDKTVGRLLENMLGLTQETLPQRKIVPLTIDYTGSTITITSNEDNVNTALAYHDIFS
TAQNIEKKNNLMYIQKGTTVINIKVPYVWQGAIVSIAGIILSVVWVIALGKTGKSGKNKNENI