TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D0NGF4|D0NGF4_PHYIN Anoctamin-like protein OS=Phytophthora infestans T30-4 GN=PITG_11203 PE=4 SV=1
MPSLADAYDAFTSPATAHSAVDMEFSSMQSAQSFVLHSTSSDKTLYDHDLVMVFPRREGGELKKPDDFTLNSFVHLMMGK
DPDRSQRADKIVVDPFQRVLRTPRCFLDERGCDVVMDSSNDHSEESEQRRLETQQQLLKSEYEQYIGTTEATTEAQFCEL
VATAIARRVQLACGLTTRMFLSCDADEIIMTIKADNDDLRVEADRTNYRLQVSNKPFDKTLHEKKLKTLQREMGDKEWQN
SIDHLRHTRGCVNEDAEYPEMDPLLVSRGEEFHPELRKALDIWGHTEEADGLFVEDDTYRRVQGSHWDRFVTSIFALPYD
PLTYFAPFAEYRHEEKFQPFYRRYPIKWEQKKEETLFSQKDRIRLAEGIVERHINADALEAAGYLQGQMFALHDAKALHD
LRHSWALHWTMLYQPLHKIRYYFGEKIALYFAWLEFYTKMLVFPAVAGIITFVYIEARQAVTGTNQQGYILIAFAVFVVL
WSSLFSELWKRKNGLLDSLWGLSGLQESFRYRPQFRGTKSYHPVTDAEEVTFESKAKRRRAFIVSVLVVTLMVGIVIVAL
FGLFVLKHWINDSDNLEHNNISAKYQTPLTFGVTVINAIQILVLNTVYRNVARKLNEFENHRTDAEYENYLVIKVFLFQF
CNSFASFFYIAFVKRAAEGSCLYEDDCMQELRDQLLTLFIIRIVVGNTTEVAVPYLKYRYQLFAERKAANTEEKTGHNYI
EEQAKLVPYESNEAFEDYNEMVIQYGFINLFVVAFPLTPLLALANNVLEVHVDAVKLCFVHRRPFPHPAKDIGVWFYILR
FMTYIALGTNSALILWTSDLFEDQTGTVRAFSFVVACQVCLVLAVLVERVVPDTPREIKLLQERYEHIVNVVFKGLFEGD
SSKLNEVAERLDLQIYPNHEWEESKQHYA