TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D1AL54|D1AL54_SEBTE Uncharacterized protein OS=Sebaldella termitidis (strain ATCC 33386 / NCTC 11300) GN=Sterm_2344 PE=4 SV=1
MTKNKLTYHKVSDIIIMYSGVHENLTKKVMNMKKKLLLVAVFALLSISLSAKETDKTEAVTESRNKVTSPWDGWHGTFGI
LQETENVEGSGDKDGLYEPSVYFDLRKGKWSFGMTNYNENHDFDYSDWTRGNYLNRLELRAHYQFTDNDKYAVGLGAALR
NYQWFHKDGTSPTTTNNRWLNIQPDWRYNFTSNLSYEGWLGLYSMFNDAQENGYSDKELETESGLKYKFNDFISVRLNYY
LDRGWNLGGPTENSFNNQQIRGYVPMNFAFFGEKTTTITPYFRQGFINKSWNAGANQANNEIDTRLGLRIDQQLPAGFAV
SLEYAYEMRNQQDSAPGQKSFSKFHYTGVGLSYSF