TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D1P603|D1P603_9ENTR Putative uncharacterized protein OS=Providencia rustigianii DSM 4541 GN=PROVRUST_07667 PE=4 SV=1
MKILIKSTGAALVLMTFVSQAEEFIPSGSIGVTQTFYGNAGSYKTATSHPSLLFNYNFYPKWSMALQWDRTWNMYHYDGS
EKQQDNRFSGPKGTLNYNYGVIDGSKVKWNSSLMVENEDDFDGTNQTYALMQTAFDFSEYIPKNDYIQATQFAFSPMYIY
GWNTQGPSGHVNTGILSLLTNWQLPANFSITLNAYAFREWYDGNMLITDGTQSYSNANYYMFLAWLNYSNTLYQFNDNTS
LSFNFVGGLDPYISSNKKAAWDPFIAGNQMSEWLSPTIMDGNYKSTYTLFALPQLSLNYQYNKALNLSAFVQAKYSNQVW
GSTEKDWELQPQGGVGIRYAF