TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D2N1Y9|D2N1Y9_NEUCS Pheromone receptor 1 OS=Neurospora crassa GN=pre1 PE=4 SV=1
MNNTDPWASVANITTPYTTTPEERLGPPAPYTDIGLQVNLFFRVFLGILGILIPLVPARLLWINGEFSATVHCMSTVTLN
FFYVVNSLIWRDNNVKKWYAGYGWCDFHTYVFFAVETIFHTTLFDIMLGLTNKIGNPRVTSLSPKEKKRKDRISALIIFG
NPLLQVLLTYFVITQRYDVLTLAGCNAVFDPNGVFFVFFILPSPVFTVGAAGLAGVCFYKYRQLEKLTREVLPSDDSIRT
ARQKRLRRKLYFLTLSILVLVVPIVCVFFVFNLIQGWPWTLPFDLHRIHANINFVSFTTTERMQVSTVLTNYVPVVSSVA
ICITFGTTVEAYNQYRLVLVFLGLGKIWPKLYQEYDPDESEPPSELSTQTSSQSWWSSMTKNGKRGTVTSHSGNDFSILP
NTEDIPLTNRLNPAQTTGEGSHTVPRSPYEEFRKEFSDLYPSQSSPTANVDHNPWPDLSDDPSPPARNPWYLRPNAFHVP
ITLPMPLSPIYIPSLHAGQAKKTEGKQKRTTVNKLSQGYTTLSSSSTTILPPSSSPTCPLPPIPTPTFSSRHSPQEERYR
ATRKAQKQKEPGTLHSTGNGSLKNPLMPAAPWSPFASSHTNTALGVDTRVWSQKDKDDSAGHAQDSPISHSSRSTTGPPQ
LPLPPSYSVAVGQESSFASASDRSTGLGISPPENQQIGTALGHPPRGGVVRVETHIASEIEVISGPGRGDWNDRDDDQRS
GREW