TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D2RXA5|D2RXA5_HALTV Phosphoenolpyruvate-protein phosphotransferase OS=Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734) GN=Htur_2756 PE=4 SV=1
MAANESAPRAHEGTGVTPLSGVGTAVWYDPNAELELGEPPAAETVDPDAERERFEDARDRARAELERERERTAERVGEDE
AAVFDAHKQFVDDPQIIDGVEAAVDDGLPAEHAVDAAFEDPIAQFEGMDGRMAERADDLRDVRDRLLRLLTDADRVDLAS
LSDGSILLAERLTPSDTAQLDPERVAGFATIEGGRTSHAAIFARSLGIPAVVGVGDGLESIDDGADVLIDGEEGTVIANP
TPDQRERAAGGRDVEIREDPVETADGRAVEVAANVGTLAELEGAVAQGADGIGLFRTEFLFLDREAPPDEDEQFEVYREA
LAAFPEGRVVVRTLDVGGDKPIPYLETPDADNPFLGQRGIRRSLGPDADLFETQLRALLRAAAAESGTLSVMFPMVATVP
ELEAALETVADVAADLESEGIEHERPELGAMIETPSAAFIADELAERVDFLSIGTNDLTQYVMAAARENERVADLRDPCE
PAVLRAIERTVAAADAGDAWVGMCGEMAGDPDLAPLLVGLGLDELSMSAVTIPEVKAAIANIETDAAEALANRATDAATR
TTVYEHVNTTTDQ