TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D4ZJA6|D4ZJA6_SHEVD Sodium-type flagellar protein MotY OS=Shewanella violacea DSS12 GN=motY PE=4 SV=1
MWLRVLVASTLCMPFFATAELRHYVASLDQSQWKLSGNTPIICRLEHNIPSYGKAVFTSIAGKNHNLNFTLDMWLKPDKV
TQATLMSKAPAWRPGILSKEITELTYQKYFSGEVPRNAAWSMLAELERGMEPTFYYADWYNQSNKIAVGLSAINFNRKYG
EFRACLAGLLPYSFDDIAFTVLTYESGGSELTRFSKSQIAKVQEYLAYDSEVELVLIDAYTDSYGGRSINQKVSEQRADS
VKNFFLSAGINQDRIYTVGHGERRHVASNATIDERGRNRRVVIRISKPM