TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D5BDU3|D5BDU3_ZUNPS Colicin V production protein OS=Zunongwangia profunda (strain DSM 18752 / CCTCC AB 206139 / SM-A87) GN=ZPR_0324 PE=4 SV=1
MNTIDIILGIVLLYGLIRGFFRGLFAEVAALVGLIAGIYGAIYFSYILSDFLARHVNWDEGAINLFAFAITFILILFLVT
LAGKFLTKVANLAALGMINKILGAVFGLLKLAFLASVVIMFFRATEEQIDLVEDKTIEESVLYQPIAMLAPVLLPTILKE
ARERDIWNPLDNSEAKEDQQGE