TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D5FKJ1|D5FKJ1_PSESY Amino acid exporter protein OS=Pseudomonas syringae pv. syringae GN=mrsC PE=4 SV=1
MNVHLYLSFILTSLIVLVVPGPSFAYAIAVGMRSSRQVICRNALGMALGGLTITMALAFGVAQLFAAYPAAFVALKFIGC
AYLVALGVRTFLTRPEDKHACTIETSATPLLQGFIVETANPKAILFYVSLVPQFADPELGHMEAQLLILGATFVALQVTW
DIALMLGVHRLGAITGGLMSMKAQRIINRISGTTFIVLGLALLTQERPNS