TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D6Z9R0|D6Z9R0_SEGRD MspA family protein OS=Segniliparus rotundus (strain ATCC BAA-972 / CDC 1076 / CIP 108378 / DSM 44985 / JCM 13578) GN=Srot_0096 PE=4 SV=1
MFDAIFRSNEVGAVSKVSGRTKRYRVRKNTTLGALSAALFTAVLGASSSYGQGLPDTVLHDVSEDGWEMVVETLDEEVNP
VANLADTAFTREGFVQLTGVGKILGKGKYPVTAAELIIGYQIGCQIDVSQGVTLGGSLGASAGVDAYQGVGVGGIGGAGT
LVPPIGGAIIGGGGAVGGAILHEGANASIGGSVQFTLRPGGIVAIPMDRIPLKGSEARLRVRNVNVKIDACGGPVNVRSF
ALLSLTTDYSHSTLATYGTEYPI