TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D8LKG3|D8LKG3_ECTSI Putative uncharacterized protein OS=Ectocarpus siliculosus GN=Esi_0030_0048 PE=4 SV=1
MPEFHFMESDWGIHAKRGGSICTATSLACTVVGFIFWRWFGAVLSLAIGLLLATFEVPFVYKCFEPCRRLETILNDTLKF
SIPAVRAVLYLCLAIVAFTSNLLNIVLGVLLLLTAILYAFAQIVGSAITDTTTVPSDAAPADGQTPFGTFT