TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D8LWX8|D8LWX8_BLAHO Singapore isolate B (sub-type 7) whole genome shotgun sequence assembly, scaffold_1 OS=Blastocystis hominis GN=GSBLH_T00001044001 PE=4 SV=1
MLKELKTFRLSVWGKWLGYLASLFCLGALFSFGKYSNFFHWIIALVLLLAVVALIWFPCFKCFSSIKNINEKLSAAHNPL
IIGVVMLLTCWSFWKPTIIGAILIGIAGLFDIIGSFVDKKGGNDSMV