TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D8QVS6|D8QVS6_SELML Putative uncharacterized protein OS=Selaginella moellendorffii GN=SELMODRAFT_404579 PE=4 SV=1
MASSGIFFFVLFVLYVSTVAAQNVHFGYGVYLPTTDLGSPLRTLRPIFNERANEFLLTENYTSVKNNHAHTSNNEELYKS
FGVTFGMNVPIKVLQLNIEASFNKIAGSKTSIRTTSVFVESYNQRIYLRDHRRAIQTLPLNSDFLSDLRNLPEPPSSDSA
WGPYQSFLNKWGTHYVAEMFHGSWLRQWTVASSTATFTQRQMQAKACAKLTGLKGVLPNMEGCAGITLEEMRAAEGINTQ
DTREARGGSSATVSQLLSGDITNDLIRKFIEEGATSKEAVRYGFFPVWVPVLSQYMSSASKEWRVATALQAYYEGFLAFK
CPLDQLNTPATVLQQFRRLSNGKYQCVRQCQGCRLDKDCNLSGVSGCYCYGNSCINALGPDGRAQVQRQKDNLDRNVLPN
RSCEYKFPQCRCNTKSKEANCGADNMIPIWDQGQNSIAIDSDILLYDEE