TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D9T6D3|D9T6D3_MICAI Large conductance mechanosensitive channel protein OS=Micromonospora aurantiaca (strain ATCC 27029 / DSM 43813 / JCM 10878 / NBRC 16125 / INA 9442) GN=Micau_0312 PE=3 SV=1
MLKGFKDFIMRGNVVDLAVGVVIGAAFTGVVTQLTKSFLEPLVRVFIALITGSKDGLSGSTPKFRGIPFDWVAFVNAAIT
FVLTAAALYFLVVYPMNRLAERRKRGEEPPPSAPSEEVKLLTEIRDALLAGNHGTPGQRSALDDVLGRRQEPPAPR