TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E2E5H6|E2E5H6_DROME Odorant receptor 10a OS=Drosophila melanogaster GN=Or10a PE=3 SV=1
MSEWLRFLKRDQQLDVYFFAVPRLSLDIMGYWPGKTGDTWPWRSLIHFAILAIGVATELHAGMCFLDRQQITLALETLCP
AGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAARINFWPLSAGFFTCTTYNLKPILIAM
ILYLQNRYEDFVWFTPFNMTMPKVLLNYPFFPLTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRP
YTDHLELSPVQLYILEQKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVXGFSMVNLLTLGNNGLGAMLYVAYTV
AALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSMAVPFFSPSLATFAAILQTSGSIIA
LVKSFQ