TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E3H7R5|E3H7R5_ILYPC Putative uncharacterized protein OS=Ilyobacter polytropus (strain DSM 2926 / CuHBu1) PE=4 SV=1
MKKKIALLLAGLSIVSGTALGASFKLTDEIKINDETNYRSDERTKTEWTIAKGEYKADNGLKLKFDVDRDDINYDASGYE
DHEGWDTYFAAYYPLASVELGGLTFKNEIGAEMYYDQEDSYDKNGSDQTEKEETELGLALKTKTKLNDTTTWSTKLWARN
IDYEKGTTDEDEVLYGIETSMGMDFNRNWSAEVEVDGFWGGYSDSANTFAGDGIDSFNYEVFAYLDYAQDLYKTDNFKLF
FSTEFAMEFYAQGDDYKDAEEDYSEYYIQPGLGFKYGVTESVALHGWTGYKVLGETANGDGTVDDNNEWESVVGFKVAM