TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E3HAM6|E3HAM6_ILYPC Uncharacterized protein OS=Ilyobacter polytropus (strain DSM 2926 / CuHBu1) GN=Ilyop_1433 PE=4 SV=1
MKKRLIVTLAGLLALGVMAPAATGWVRNWAELTENRPTNNDTGSNSQNVEWTLVEGSIDMTDKLAVTFDVEKNYKNVTNG
DDLETYWDNRFGLSYDLGKSGDWDLAAGLDYYYDTNGSDDVTQSSYSPWLEASTALTDNTTLTLWGAMYYQDGVETGVHG
DDYELDILLDTGKLGIFDWTGTWLYLYHNTSGGHGSNENTSAELEMEAFSTLYKHDSGAYVGLEYYADGTAGDKASESLN
AHIAPRVGISKKLDNDVSLWAYTSYEVISVNYAEGGDWYSDNQFQVVVGAKAAF