TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E4VH40|E4VH40_9HELI Putative uncharacterized protein OS=Helicobacter canadensis MIT 98-5491 GN=HCMG_01600 PE=4 SV=1
MKFIKLSLAASVALGALSTASFAQPLEEAIKGIDVSGYLRYRYNDDRYNDSTGNAAHQWRAVADFKTPVVNNVALNFGVW
YQNENNVNHGKGTGNETPGTAQAFTGSGLGSGSDGQFGVREFYATITPDSTATTIKIGKQLLDTPVTNAYDRDRGTGILA
LNSDIPNLTLAAAAFDSWSINEVNAQNQINNAGGVVTNNGGGSLINNGLSNDYSIDKPLYALAGIYGIDTNYGRFGGQLW
GFYIDDTVDALVFGELSWQGSLLRAKLQYSFAALNNDSDSIFAGLYGYGTANRNKANISEANDAFVVEVGADFRNDFQLP
LNVALGYITNFADGTAVALEDEGSNVSRKGKIWWQNAGTGISTSVLRGYGVQGFGTEQDIDVFYAGVDYSFLDERLNVGL
EFAWGENDISYNRVAAANNNIIKKVEFTEITPTITWKHSKQLTLSTYYAFLKNDYTYVTPVAGQDQDRDRFRVEAKYSF