TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E6L3Z4|E6L3Z4_9PROT Pyruvate ferredoxin oxidoreductase, alpha subunit OS=Arcobacter butzleri JV22 GN=porA PE=4 SV=1
MRKISKLSLVAAVAVAGFSTANAQPLEEAIKNVDVSGSVVYRYNDYNNDSTDAVSAGKGSSTNNNYKIGLNLSSKVNDYV
KFNSRFIVGQPSSNGGAAGANGNSGFATLDSNDNGDQNVDVTLSHANFAFTGIKNTTITAGKQGLATPWTVALDSDGNEQ
TGTGVLALTTFGPVTAGAGYFNQTNLDNNGDAVINNVGNVSAQLDGSKDVVVGALIADLSPVTLDAWYLDLDDTFDTYTI
GAKSDFKFDGGKIGIDARYVSLTLDKAVAEALTDNKEDNALAKIVVTGNLGIFNAKVAYANTDKDGGLTSLDNDAEATLL
GWSITSNGKADADYWQAVLGVNILDNLNLSANYGNIQYKEDNTTSDEVEEEEIYAQLTYKMSKNLNTYVRYGTYTKENKF
GASDNKDINDDLRGRLQVEYTF