TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E8X5B7|E8X5B7_ACISM Colicin V production protein OS=Acidobacterium sp. (strain MP5ACTX9) GN=AciX9_2428 PE=4 SV=1
MQLPPTTSYNPFDWFLVVILVISTIAAFMRGLIRSLLSLVGFILAIVVASWNYLSFASYLGRWILNFTVAEIIAYLTILI
VITIAFSMLANLLRKTASAVGLGFLDRLLGAAFGVLRGFLAGVAAMMAIAAFSPNSEWVKNSQLTPYFLEGAHAVSFVVP
PRFEQQIAQGATHLLQQTPDLLKSHPRKNDRD