TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E9C7I1|E9C7I1_CAPO3 Predicted protein OS=Capsaspora owczarzaki (strain ATCC 30864) GN=CAOG_04208 PE=4 SV=1
MSYRDSFADVPLEQMSARRSNAMSPEDMFFQEQLLAEASRPSSLLIPPSVSSYGGGGEIGTVSVRSSSPVITPQRSRSNS
AYNNAPVVDLHAPTANPRGNFSNLGVVVTPLERKRQSRAIENMELASLGYHAEAHQEPQPALQPADHSGAGVPAAEAAPA
ARKGKTKAVASAAPPPEENLDAPSRKLLRSLSSNHLDATTQVEAREILDMLPSELRFHTRQLEEQLQSAEGFHSPLVQSY
SIGDTATILSQQAEVRRLKHRPTLKNVKRTRSTEMYSEHEVAERTQSLKMEIGATKTKNLQKERENLGHSMTKWIRYLKH
RYQRKKVLQKDPVPIFRHSIKVIEGRLGTAVASFFVFTRWLFLLNIGLSIIWLSLTTFPQLSQTTGNSSVDFNALNLLTG
GGYLATTPMFYAGYDNSVPHYSMDLSYVIAIGVTYLISFFAILYSLGAKFSRDRDPTTLVARDSTYPFAVAVLGSWDYSI
RDDNGAVTMHLGIAHTLKEIYSRQETAQAVLTTKETAKRFVRRLISMTVSLLILALCAYLVYVLIDLQASHAFDDGAIQL
VAPASISAMNILVPWIFTKMLEVEKWSSQDVELRVTVYRSFFVRLAAVIAVIVSIWQTRQSNLATQCWQNRIGQEMYRML
VIDLIVSSIFTIVQQFGWRYMKDKILHRGNKVDFDMSKNVLDMTYRQTLIWLGCLFCPVLPAIGSISIIITFYIRKFVYL
RVSKQPRRFFSAARSNSFFLLTLLMTLILVFIPVGYILVDGQPSCGPHKNLDSIYSIVPYWLRRGPSWILAITNYLFTVA
FLVPFSLLLISALYYMHASKKGIKERLKETTLQLDMEREDKRYLLKQYRIN