TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E9QIV8|E9QIV8_DANRE Uncharacterized protein OS=Danio rerio GN=wu:fa92h10 PE=4 SV=1
MAYPTTLELIGGQGGSSFSFTGEKNGASLEKIWVWVGEWQIRAIRAWLSDGRNKTFGEPSGSHQEYVFSPGELFTSLSLW
GNGAGTRLGAIKFITSKGNEFFVKMTKWGLKQEYPIDVGSGYCLGIVGRSGADIDCMGFMFLYAVQSSVLTNVNYPTINQ
QIPKVAVEDINSITFDNNTSVNQNKALASSNTVIKTCSWSMTSSFSSTFSVGVKAGIPDVAEGSMGFSFSLGSEHTYGLE
ETDERNETLVTSVNIPPQKKVDVGITIGRATFDLPYTGTVKITCKNGSELQYETKGIYKGVTYTDIKVKTVEKDL