TCDB is operated by the Saier Lab Bioinformatics Group
>ETO30210.1 hypothetical protein RFI_06914 [Reticulomyxa filosa]
MSHDNNEKKPVKDTWEMPTLRALMGEIGSAAVGGMIHSFIETPIVIPIEASITQTQINGRNFFWNFDYVYICTDLTAICL
LLFRLFIGFQKKKTTDGLSFIRTCLRLFFSCVPVVPFFVIKKGSMRDATLKQSVTVGLATGGSEVILSTPLNFLKFRMQR
PEWGYKGLLDAIRRIAKEEGIGAYWKGTLPTFCRNSTCMAGMLGGISVLKPLFPQDFARKNLLAGMGGGLIGSLISYPFE
MWRAARMHNRNFYEEMWSRGPRRMLAGWAPGATRLVITSGIMGELLPRLKQWANAMSKEDAPKQKTEAKPTPPQPNQSTA
NSGNSNEKKK