TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F0JDF9|F0JDF9_DESDE Colicin V production protein OS=Desulfovibrio desulfuricans ND132 GN=DND132_0110 PE=4 SV=1
MNFLDIVLICIVALFLLRGFFRGLVQEVLSLIAVVLAIFLASRFDDVLAPHLKLYIESDITVSALSYSLIFIGTLVLVWL
LTKLIRSVLEISLLGWIDRTLGGIFGLLEGVLICLVGLMFLQTFAPRSDILTESYIAPKAQHLVGKLGEYVDLPEALDSA
KSALGIPGGDKAE