TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F0TFC1|F0TFC1_LACA3 Uncharacterized protein OS=Lactobacillus acidophilus (strain 30SC) GN=LAC30SC_06455 PE=4 SV=1
MTTKDWIYLGITVASYLLAIIAGVYARNKAKINTTTKAGQALDVLGKLATNAVHEAEYIGGSGQEKREFASEIIEQALSW
FGIKGVTSSEVNGAIEKAVNAMNIANQDVKPTEPEIAQNVPEKDIVQPEAPAKDVTVNGN