TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F1BYM0|F1BYM0_9BETC Putative ORF3 protein OS=Zaria bat coronavirus PE=4 SV=1
MDYFKFWSFGLVNIHKPDPVYEPVVARQSFIPHGTTISPTEHPTMLAGDICLTIFLLVYIISWFLRADSIPAVILRFALT
LITGTFLVIGLFLEQPSLVLKIAVAVTIVAYVGCISLRLALAIRCVSWLPLMADDDCFVCYQSGGYNYCFPYDPNGPYVT
LTVHNNGVTCGSHTIYGSVSVADRIQVVTIRNKNSYILQNTFDTGICIIAFYIADIAVVENHTVVGDLPKSCPEYHIYDE
PRATINVPL