TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F2PXJ5|F2PXJ5_TRIEC DUF6 domain-containing protein OS=Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97) GN=TEQG_05611 PE=4 SV=1
MSPQSFSHPAHHSHTPRDEGQFNCSTSERRSSLSRRRAAAAAESSNISSSTDIRLRELKPANTSTTLFSADDGHTKSSYN
SAEEDSDGDMAIGRPSMQRPGESRSKVPLLKGESRGRSASVGPASMEEGRSSLSRARPSFRSKSPDFGAKNATRKKYIIA
AFALFISLISFTVQTQTAVYIQQELGWNKPYCMLYLTHGSWIFLWPVQLLVLRIQKRHLTWSAFWRKHVYILQTTAQMVE
TQELHLTTRQSNKSPIPYMVRTTVFVALALTIAGGSWYVAVDLTTSSDLTAIYNCSAFFAYAFSIPLLNDKLRFDKVFSV
GVAIVGVIIIAYGPGGPPEGAPAGDAETLKASNRALGNIIIGVGSVLYGLYEVLFKRFACPPEGTSSGRGVIFANTFGSM
IGLFTLLVLWIPLPIFHLLGLETFQLPRGETAWLLIISTLSNATFSGSFLVLISLTSPVLSSVAALLTIFLVTLVDWKFN
HKALGFTSIVGGILITVAFLLLSWSTYRELDEERKKRLEDEGPDSESDE