TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F2UA94|F2UA94_SALR5 Putative uncharacterized protein OS=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) GN=PTSG_05382 PE=4 SV=1
MAGMIESLCGWRLAARICGVFATLVLMIGGILTIISLSAICWVVGIYMLCCSFVVGVLEVPVICQCIDFAKPWTTRAEKV
PSGYRALAYMLLCVFMFFCLGVSSILAGLLTFGTGFLYFMDWLGPPRVRNAVQMQLQEGIADDEESLIGSTEEVKEGQTG
VGWMDTVTEQAGKAVARAAVSEMQSQWTGQSTK