TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F2UIG4|F2UIG4_SALS5 Putative uncharacterized protein OS=Salpingoeca sp. (strain ATCC 50818) GN=PTSG_08258 PE=4 SV=1
MDDGGRADAENAMREQRAGEEQGEEQGDEVWEDPAEDTEEEEQQQQQQQQVQPDELQGQQEQQGQGQQQPAAERPSRMSA
WDDENLNAQHPEQQHEEEEGRPHRASVIHFDDHVAPRPSANAPSAASDTVNGVMNGMNGGNRDTHINGGTDHQGSTGNGN
DHHHHHHQHHDDDDNGNNSNNHSESVQHDDVVLSVGDMSVTSPVSTLSDLTYTGRRLNTHPAVRHAVHTNQMTVDFARAM
IPQRADKLYGEYIADRIRLAGLRINTLSTGDPVDFVLVYSLGKYDEEEIAERVLDPHHADGSEEKRERERLRFELNLMRK
GLVIERESSGKHIAIVKVHCPFKRLCERAQVMQMKLPLKKDPVYERLQNDEVLALKYRLRRVFEAVLPDAWAARMFFDDA
SRFDTDRSSTAHFSIEHAEKFENFETPHKFFSPAQRSVLVRYILLNTKYGHNAVPDSKAETKVGIDRLMRKGTYVDAFPL
HDSSFDLPSEIDAMRGEVVCSPTKQKHSSRKHTFDNNRINAYGLRAILLETWGRFWCVLRAQPLGLVREYFGEKVAFYFA
WLGFYTTWLIIPSVVGFLTLFYGVAQFQGRADTTQVCQSNVTMCAVCDTCEKWQLNSSCTAAEATYIFDNEATIAFAFFM
SLWATVFTEYWKRSQAELSFDWNMVDHDDFEPLRPQFRASTTRKNLITDQNEPHYPAYRRYLKYILTASTVLTVCATVII
ILISTIVYRIAVYTAYVTRQPDQQDQASLIASGTAAVINLILIITLSFFYRYLAVWLTDWENHKTTSKYEQHLTIKIFTF
QFFNSFGSLFYIAFFQHQDIGVPGDYDTFFGYQSDSCPAYGCLLELTIQLAVIMVGRQAFNNVLEIGLPLLKAWWRKCRL
RLKTTQHNDLLPWEEDYLLLDAYPRLGLFDDYLEMCMQYGFITLFVASFPLAPFFALINNIFEIRVDASKFIGLWRRPIA
ERAAGLGLWRQVLEFLTLASVITNGMVISFTSNFVDKLVYRESRGSLDGFYLAITAESPYDGPLDIYRNCRYFGVRDADG
EYKKLFYEILMGKLAFFIVFEHVVFLTKFLAQVIIPDEPRWVTIARKREVYQARAIIEGLSDTHYLNAEENEITNQGLDA
DSIASTEERDGAELRRRRPQQQQQQQSTDESII