TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F2XFM9|F2XFM9_STECR Pore-forming protein-like protein OS=Steinernema carpocapsae PE=2 SV=1
MKFLFAFILIAGFVVVSESKLLCNICQDLVGALENEAESNEGSIVDRANNECDKLTHDNMLLDPICKAIIDAGIDKVEDD
IKNKEPASKICKKLHAC