TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F4FC13|F4FC13_VERMA Cytochrome C biogenesis protein transmembrane region OS=Verrucosispora maris (strain AB-18-032) GN=VAB18032_24565 PE=4 SV=1
MSQTGYLAALLGGVLALLSPCSAMLLPAFFAYAFQHPRRMLARTGVFYLGLAAVLVPLGVGSTVVANVFFQHRDTLILVA
GWSIIALGVVQLAGKGFAFGPAQRLLGRITGNSPLSIFALGAVYGLAGFCSGPILGGILTVAATSARPAIGGALLAVYAL
GMTVPLLLLALVWDRWRIAERRWLRGRSFAVGRLRLHTTSTLSGLLFVALGGFFLAFDGTAGLTGGFGLTDIESTAQEWI
TGTLGDVPDEWVLLVVGLAAAAVLIHRRRRSAAESATSRQGTSSDPATDMERTSAGPVAALPSAAGLAGVNVRPDRAAWS
ARRWWVAVLGAVVTTVVIAVPTALIDTPFFGREVAVTWWAWPVLVVTAVLSGLLLATYVGPAGPAAGRTGTRTGVTGATL
SLFAVGCPVCNKIVLLALGYSGAMSWFAPAQPVLAVASIVLLGWALRRRLAGERACPTPAGSKLLTADGTVDR